PDB entry 1ywu

View 1ywu on RCSB PDB site
Description: Solution NMR structure of Pseudomonas Aeruginosa protein PA4608. Northeast Structural Genomics target PaT7
Class: structural genomics, unknown function
Keywords: PA4608, PaT7, beta barrel, PilZ domain, structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-03-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA4608
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4608
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ywua1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywuA (A:)
    mgsshhhhhhssgrenlyfqghmsdqhderrrfhriafdadseilqgerrwevllhdvsl
    hgilvgqpqdwngdpqrpfearlylgldvlirmeislawardgllgfecqhidldsishl
    rrlvelnlgdeellerelallvsahddgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywuA (A:)
    msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear
    lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv
    sahdd