PDB entry 1ywt

View 1ywt on RCSB PDB site
Description: Crystal structure of the human sigma isoform of 14-3-3 in complex with a mode-1 phosphopeptide
Class: signaling protein/de novo protein
Keywords: protein-phosphopeptide complex, 14-3-3, SIGNALING PROTEIN/DE NOVO PROTEIN COMPLEX
Deposited on 2005-02-18, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywta_
  • Chain 'B':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywtb_
  • Chain 'C':
    Compound: sythetic optimal phosphopeptide (mode-1)
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1YWT
  • Chain 'D':
    Compound: sythetic optimal phosphopeptide (mode-1)
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1YWT (0-End)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywtA (A:)
    merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
    vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
    lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
    yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtadnageegg
    eapqepqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywtA (A:)
    merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
    vlssieqksnpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdyy
    rylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspe
    eaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ywtB (B:)
    merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
    vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
    lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
    yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtadnageegg
    eapqepqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywtB (B:)
    merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
    vlssieqkspevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdyyr
    ylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspee
    aislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.