PDB entry 1yws

View 1yws on RCSB PDB site
Description: Solution structure of YBL071w-A from Saccharomyces cerevisiae.
Class: structural genomics, unknown function
Keywords: Zinc finger, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein YBL071w-A
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: YBL071w-A, KTI11
  Database cross-references and differences (RAF-indexed):
  • GB NP_660100 (0-81)
  Domains in SCOPe 2.08: d1ywsa1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ywsA (A:)
  mstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdk
  edlaeyyeeagihppepiaaaa