PDB entry 1yws

View 1yws on RCSB PDB site
Description: Solution structure of YBL071w-A from Saccharomyces cerevisiae.
Class: structural genomics, unknown function
Keywords: Zinc finger, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein YBL071w-A
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YBL071w-A, KTI11
    Database cross-references and differences (RAF-indexed):
    • GB NP_660100 (0-81)
    Domains in SCOPe 2.07: d1ywsa1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ywsA (A:)
    mstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdk
    edlaeyyeeagihppepiaaaa