PDB entry 1ywq

View 1ywq on RCSB PDB site
Description: Crystal structure of a nitroreductase family protein from Bacillus cereus ATCC 14579
Class: oxidoreductase
Keywords: Bacillus cereus, nitroreductase family protein, FMN, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, OXIDOREDUCTASE
Deposited on 2005-02-18, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitroreductase family protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywqa1
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywqA (A:)
    msatttnlkeaivnrrsirkvtkndaitkerieevlktalhaptsfnmqsgrmvvlmdge
    hekfwdivketlrarvpaenfeatverlkgfhagvgtvlffedqatvekmqenaplykdq
    fpfwshqgnamlqhtvwmllsaegigaslqhynpivdaevketwnipaewslvgqmpfge
    pneqpaertflptedvvkfy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywqA (A:)
    satttnlkeaivnrrsirkvtkndaitkerieevlktalhaptsfnmqsgrmvvlmdgeh
    ekfwdivketlrarvpaenfeatverlkgfhagvgtvlffedqatvekmqenaplykdqf
    pfwshqgnamlqhtvwmllsaegigaslqhynpivdaevketwnipaewslvgqmpfgep
    neqpaertflptedvvkfy