PDB entry 1ywo

View 1ywo on RCSB PDB site
Description: Phospholipase Cgamma1 SH3 in complex with a SLP-76 motif
Class: hydrolase, signaling protein
Keywords: SH3, Phospholipase C-gamma1, SLP-76, SH2 domain-containing leukocyte phosphoprotein of 76 kD, HYDROLASE, SIGNALING PROTEIN
Deposited on 2005-02-18, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.173
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PLCG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10686
      • engineered (6)
    Domains in SCOPe 2.07: d1ywoa_
  • Chain 'P':
    Compound: lymphocyte cytosolic protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywoA (A:)
    gsptfksavkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyve
    emin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywoA (A:)
    savkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyvee
    

  • Chain 'P':
    No sequence available.