PDB entry 1ywn

View 1ywn on RCSB PDB site
Description: Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
Class: transferase
Keywords: transferase
Deposited on 2005-02-18, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7100000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (Start-315)
      • modified residue (198)
      • modified residue (203)
    Domains in SCOPe 2.08: d1ywna_
  • Heterogens: LIF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywnA (A:)
    mdpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtv
    avkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnls
    tylrskrnefvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnil
    lseknvvkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvll
    weifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfse
    lvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywnA (A:)
    lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlthsehralm
    selkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpfltleh
    licysfqvakgmeflasrkcihrdlaarnillseknvvkicdiykdpdyvrkgdarlplk
    wmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdy
    ttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqd