PDB entry 1ywm

View 1ywm on RCSB PDB site
Description: Crystal structure of the N-terminal domain of group B Streptococcus alpha C protein
Deposited on 2005-02-18, released 2005-03-08
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C protein alpha-antigen
    Species: Streptococcus agalactiae [TaxId:205921]
    Gene: bca
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02192 (Start-186)
      • cloning artifact (187-197)
  • Heterogens: DTU, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ywmA (A:)
    masmtggqqmgrgsivaastipgsaatlntsitkniqngnayidlydvklgkidplqliv
    leqgftakyvfrqgtkyygdvsqlqstgrasltynifgedglphvktdgqidivsvalti
    ydsttlrdkieevrtnandpkwteesrtevltgldtiktdidnnpktqtdidskivevne
    lekllvlklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ywmA (A:)
    stipgsaatlntsitkniqngnayidlydvklgkidplqlivleqgftakyvfrqgtkyy
    gdvsqlqstgrasltynifgedglphvktdgqidivsvaltiydsttlrdkieevrtnan
    dpkwteesrtevltgldtiktdidnnpktqtdidskivevnelekllvlklaaalehhhh