PDB entry 1ywl

View 1ywl on RCSB PDB site
Description: Solution NMR structure of the protein EF2693 from E. faecalis: Northeast Structural Genomics Consortium target EFR36
Deposited on 2005-02-18, released 2005-03-29
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0213 protein EF2693
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF2693
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q830S9 (0-87)
      • cloning artifact (88-95)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ywlA (A:)
    menkkshyfyvllcqdgsfyggytteperrltehnsgtgakytrlakrrpvimihtekfe
    trseatkaeaafkkltrkqkeqylktfhlehhhhhh