PDB entry 1ywj

View 1ywj on RCSB PDB site
Description: Structure of the FBP11WW1 domain
Class: Structural Protein
Keywords: WW domain, Class II, Proline-rich peptides, protein-protein interactions
Deposited on 2005-02-18, released 2005-04-12
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-12, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Formin-binding protein 3
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75400
  Domains in SCOP 1.73: d1ywja1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ywjA (A:)
  gsrrasvgsaksmwtehkspdgrtyyyntetkqstwekpdd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ywjA (A:)
  smwtehkspdgrtyyyntetkqstwekp