PDB entry 1ywi

View 1ywi on RCSB PDB site
Description: Structure of the FBP11WW1 domain complexed to the peptide APPTPPPLPP
Class: Structural Protein
Keywords: WW domain, Class II, Proline-rich peptides, protein-protein interactions, Structural Protein
Deposited on 2005-02-18, released 2005-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Formin-binding protein 3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75400
  Domains in SCOPe 2.06: d1ywia1
• Chain 'B':
  Compound: Formin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1YWI (Start-9)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ywiA (A:)
  gsrrasvgsaksmwtehkspdgrtyyyntetkqstwekpdd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ywiA (A:)
  smwtehkspdgrtyyyntetkqstwekp
  

  
  
• Chain 'B':
  No sequence available.