PDB entry 1ywg

View 1ywg on RCSB PDB site
Description: The structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum
Class: oxidoreductase
Keywords: Rossmann fold, Dehydrogenase, Tetrameric, OXIDOREDUCTASE
Deposited on 2005-02-17, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: 3D7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywgo1, d1ywgo2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: 3D7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywgp1, d1ywgp2
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: 3D7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywgq1, d1ywgq2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: 3D7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywgr1, d1ywgr2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ywgO (O:)
    mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev
    thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi
    msappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvh
    astanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpi
    gtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdm
    kaglalndnffklvswydnewgysnrvldlavhitnn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ywgP (P:)
    mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev
    thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi
    msappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvh
    astanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpi
    gtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdm
    kaglalndnffklvswydnewgysnrvldlavhitnn
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ywgQ (Q:)
    mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev
    thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi
    msappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvh
    astanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpi
    gtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdm
    kaglalndnffklvswydnewgysnrvldlavhitnn
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ywgR (R:)
    mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev
    thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi
    msappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvh
    astanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpi
    gtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdm
    kaglalndnffklvswydnewgysnrvldlavhitnn