PDB entry 1ywc

View 1ywc on RCSB PDB site
Description: Structure of the ferrous CO complex of NP4 from Rhodnius Prolixus at pH 7.0
Class: ligand binding protein, blood clotting
Keywords: ferrous heme; carbon monoxide complex; lipocalin fold; beta barrel, LIGAND BINDING PROTEIN, BLOOD CLOTTING
Deposited on 2005-02-17, released 2005-10-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.121
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.05: d1ywca_
• Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ywcA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk