PDB entry 1ywa

View 1ywa on RCSB PDB site
Description: 0.9 A Structure of NP4 from Rhodnius Prolixus complexed with CO at pH 5.6
Class: ligand binding protein, blood clotting
Keywords: ferrous heme; carbon monoxide complex; lipocalin fold; beta barrel
Deposited on 2005-02-17, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.89 Å
R-factor: 0.121
AEROSPACI score: 1.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOP 1.73: d1ywaa1
• Heterogens: PO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ywaA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk