PDB entry 1yw6

View 1yw6 on RCSB PDB site
Description: Crystal Structure of Succinylglutamate Desuccinylase from Escherichia coli, Northeast Structural Genomics Target ET72.
Class: hydrolase
Keywords: alpha-beta protein., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2005-02-17, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.227
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinylglutamate desuccinylase
    Species: Escherichia coli [TaxId:562]
    Gene: astE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76215 (5-326)
      • cloning artifact (2-4)
      • modified residue (5)
      • modified residue (66)
      • modified residue (106)
      • modified residue (109)
      • modified residue (270)
      • modified residue (272)
      • modified residue (280)
      • modified residue (321)
    Domains in SCOPe 2.08: d1yw6a1, d1yw6a2
  • Chain 'B':
    Compound: Succinylglutamate desuccinylase
    Species: Escherichia coli [TaxId:562]
    Gene: astE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76215 (5-326)
      • modified residue (5)
      • modified residue (66)
      • modified residue (106)
      • modified residue (109)
      • modified residue (270)
      • modified residue (272)
      • modified residue (280)
      • modified residue (321)
    Domains in SCOPe 2.08: d1yw6b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yw6A (A:)
    magdpmdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgn
    etapvemldallgaishgeiplrwrllvilgnppalkqgkrychsdmnrmfggrwqlfae
    sgetcrareleqcledfydqgkesvrwhldlhtairgslhpqfgvlpqrdipwdekfltw
    lgaaglealvfhqepggtfthfsarhfgalactlelgkalpfgqndlrqfavtasaiaal
    lsgesvgivrtpplryrvvsqitrhspsfemhmasdtlnfmpfekgtllaqdgeerftvt
    hdveyvlfpnplvalglraglmlekislehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw6A (A:)
    gdpmdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgnet
    apvemldallgaishgeiplrwrllvilgnppalkqgkrsdmnrmfggrwqlfaesgetc
    rareleqcledfydqgkesvrwhldlhtairgslhpqfgvlpqrdipwdekfltwlgaag
    lealvfhqepggtfthfsarhfgalactlelgkallrqfavtasaiaallsgesvgivrt
    pplryrvvsqitrhspsfemhmasdtlnfmpfekgtllaqdgeerftvthdveyvlfpnp
    lvalglraglmlekis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yw6B (B:)
    magdpmdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgn
    etapvemldallgaishgeiplrwrllvilgnppalkqgkrychsdmnrmfggrwqlfae
    sgetcrareleqcledfydqgkesvrwhldlhtairgslhpqfgvlpqrdipwdekfltw
    lgaaglealvfhqepggtfthfsarhfgalactlelgkalpfgqndlrqfavtasaiaal
    lsgesvgivrtpplryrvvsqitrhspsfemhmasdtlnfmpfekgtllaqdgeerftvt
    hdveyvlfpnplvalglraglmlekislehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw6B (B:)
    mdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgnetapv
    emldallgaishgeiplrwrllvilgnppalkqgkrychsdmnrmfggrwqlfaesgetc
    rareleqcledfydqgkesvrwhldlhtairgslhpqfgvlpqpwdekfltwlgaaglea
    lvfhpggtfthfsarhfgalactlellrqfavtasaiaallsgivrtpplryrvvsqitr
    hspsfemhmasdtlnfmpfekgtllaqdgeerftvthdveyvlfpnplvalglraglmle
    kis