PDB entry 1yw5

View 1yw5 on RCSB PDB site
Description: Peptidyl-prolyl isomerase ESS1 from Candida albicans
Deposited on 2005-02-17, released 2005-04-26
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl prolyl cis/trans isomerase
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yw5A (A:)
    maststglppnwtirvsrshnkeyflnqstnesswdppygtdkevlnayiakfknngykp
    lvnedgqvrvshlliknnqsrkpkswkspdgisrtrdesiqilkkhlerilsgevklsel
    antesdcsshdrggdlgffskgqmqppfeeaafnlhvgevsniietnsgvhilqrtg