PDB entry 1yw4

View 1yw4 on RCSB PDB site
Description: Crystal Structure of the Succinylglutamate Desuccinylase from Chromobacterium violaceum, Northeast Structural Genomics Target CvR22.
Class: hydrolase
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2005-02-17, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinylglutamate desuccinylase
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: astE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NU26
      • modified residue (68)
      • modified residue (86)
      • modified residue (104)
      • modified residue (288)
    Domains in SCOPe 2.08: d1yw4a1
  • Chain 'B':
    Compound: Succinylglutamate desuccinylase
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: astE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NU26
      • modified residue (68)
      • modified residue (86)
      • modified residue (104)
      • modified residue (288)
    Domains in SCOPe 2.08: d1yw4b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yw4A (A:)
    mthspsflqhalsssdtraewplpgglaarwlapgcvelngdargadsvllscgvhgnet
    apievvdgmltdiaagqlalncrllvmfanldairqgvrygnydmnrlfngaharhpelp
    esvraaeletlaaeffagararklhydlhtairgsvfekfaiypflhdgrthkreqlawl
    qrcgieavllhtqpantfsyftsqyceadaftlelgkarpfgqndlsrfsgidgalrgll
    snpqanvpdldedklplfrakydlvkhseafklnladsvenftllpdgmliaedgavryq
    atggeerilfpnpavkpglragivveparlpsrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw4A (A:)
    thspsflqhalsssdtraewplpgglaarwlapgcvelngdargadsvllscgvhgneta
    pievvdgmltdiaagqlalncrllvmfanldairqgvrygnydmnrlfngaharhpelpe
    svraaeletlaaeffagararklhydlhtairgsvfekfaiypflhrthkreqlawlqrc
    gieavllhtqpantfsyftsqyceadaftlelgkarpfgqndlsrfsgidgalrgllsnp
    qanvpdldedklplfrakydlvkhsfklnladsvenftllpdgmliaatggeerilfpnp
    avkpglragivveparlps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yw4B (B:)
    mthspsflqhalsssdtraewplpgglaarwlapgcvelngdargadsvllscgvhgnet
    apievvdgmltdiaagqlalncrllvmfanldairqgvrygnydmnrlfngaharhpelp
    esvraaeletlaaeffagararklhydlhtairgsvfekfaiypflhdgrthkreqlawl
    qrcgieavllhtqpantfsyftsqyceadaftlelgkarpfgqndlsrfsgidgalrgll
    snpqanvpdldedklplfrakydlvkhseafklnladsvenftllpdgmliaedgavryq
    atggeerilfpnpavkpglragivveparlpsrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw4B (B:)
    spsflqhalsssdtraewplpgglaarwlapgcvelngdargadsvllscgvhgnetapi
    evvdgmltdiaagqlalncrllvmfanldairqgvrygnydmnrlfngaharhpelpesv
    raaeletlaaeffagararklhydlhtairgsvfekfaiypflhdgrthkreqlawlqrc
    gieavllhtqpantfsyftsqyceadaftlelgkarpfgqndlsrfsgidgalrgllsnp
    qanvpdldedklplfrakydlvlnladsvenftllpdgmliaryqatggeerilfpnpag
    ivveparlp