PDB entry 1yw3

View 1yw3 on RCSB PDB site
Description: Crystal Structure of the Putative Nitroreductase in Complex with FMN from Streptococcus mutans, Northeast Structural Genomics Target SmR5.
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2005-02-16, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans UA159
    Gene: GeneID:1027848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • cloning artifact (200)
    Domains in SCOPe 2.07: d1yw3a1, d1yw3a2
  • Chain 'B':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans UA159
    Gene: GeneID:1027848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • cloning artifact (200-201)
    Domains in SCOPe 2.07: d1yw3b1, d1yw3b2
  • Chain 'C':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans UA159
    Gene: GeneID:1027848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • cloning artifact (200-201)
    Domains in SCOPe 2.07: d1yw3c1, d1yw3c2
  • Chain 'D':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans UA159
    Gene: GeneID:1027848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • cloning artifact (200)
    Domains in SCOPe 2.07: d1yw3d1, d1yw3d2
  • Chain 'E':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans UA159
    Gene: GeneID:1027848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • cloning artifact (200-201)
    Domains in SCOPe 2.07: d1yw3e1, d1yw3e2
  • Chain 'F':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans UA159
    Gene: GeneID:1027848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
    Domains in SCOPe 2.07: d1yw3f_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yw3A (A:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw3A (A:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yw3B (B:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw3B (B:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yw3C (C:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw3C (C:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yw3D (D:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw3D (D:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yw3E (E:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw3E (E:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yw3F (F:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw3F (F:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgd