PDB entry 1yw1

View 1yw1 on RCSB PDB site
Description: Structure Of Ytnj From Bacillus Subtilis in complex with FMN
Class: structural genomics, unknown function
Keywords: NYSGXRC, beta-alpha barrel, FMN, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-02-16, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.186
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein YTNJ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YTNJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34974
      • modified residue (11)
      • modified residue (39)
      • modified residue (110)
      • modified residue (355)
    Domains in SCOPe 2.07: d1yw1a_
  • Heterogens: GLC, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yw1A (A:)
    mtradfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadgl
    fiseksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggr
    agwnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqf
    fdqaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsns
    leetkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavt
    ylarffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemafpr
    tlfigtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyrgg
    tlrenlglgipqhqsvlhsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw1A (A:)
    radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
    seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
    wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
    qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
    etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtyl
    areakarnltlrevaqemafprtlfigtpervaslietwfnaeaadgfivgsdipgtlda
    fvekvipilqerglyrqdyrggtlrenlglgip