PDB entry 1yw0

View 1yw0 on RCSB PDB site
Description: Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
Class: oxidoreductase
Keywords: tryptophan, dioxygenase, NESG, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, OXIDOREDUCTASE
Deposited on 2005-02-16, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Xanthomonas campestris [TaxId:190485]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PDA8 (0-End)
      • modified residue (26)
      • modified residue (91)
      • modified residue (122)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1yw0a1
  • Chain 'B':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Xanthomonas campestris [TaxId:190485]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PDA8 (0-End)
      • modified residue (26)
      • modified residue (91)
      • modified residue (122)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1yw0b_
  • Chain 'C':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Xanthomonas campestris [TaxId:190485]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PDA8 (0-End)
      • modified residue (26)
      • modified residue (91)
      • modified residue (122)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1yw0c_
  • Chain 'D':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Xanthomonas campestris [TaxId:190485]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PDA8 (0-End)
      • modified residue (26)
      • modified residue (91)
      • modified residue (122)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1yw0d_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yw0A (A:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
    pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
    rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
    lqqalaltffpelfdvrtsvgvdnrppqgsadagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw0A (A:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml
    qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf
    eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfalaltffpelfdvrts
    vgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yw0B (B:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
    pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
    rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
    lqqalaltffpelfdvrtsvgvdnrppqgsadagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw0B (B:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml
    qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf
    eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigflaltffpelfdvrtsv
    gv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yw0C (C:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
    pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
    rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
    lqqalaltffpelfdvrtsvgvdnrppqgsadagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw0C (C:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml
    qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf
    eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfalaltffpelfdvrts
    vgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yw0D (D:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
    pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
    rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
    lqqalaltffpelfdvrtsvgvdnrppqgsadagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw0D (D:)
    tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
    qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml
    qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf
    eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfalaltffpelfdvrts
    vgv