PDB entry 1yvy

View 1yvy on RCSB PDB site
Description: Crystal strucutre of Anaerobiospirillum succiniciproducens phosphoenolpyruvate carboxykinase
Class: lyase
Keywords: p-loop, domain movement, kinase, succinate, LYASE
Deposited on 2005-02-16, released 2005-07-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Anaerobiospirillum succiniciproducens [TaxId:13335]
    Gene: pckA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yvya1, d1yvya2
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Anaerobiospirillum succiniciproducens [TaxId:13335]
    Gene: pckA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yvyb1, d1yvyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvyA (A:)
    mslseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgr
    spkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcga
    nentrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglns
    etavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaif
    fglsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikr
    nallenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafg
    vlppvsilskeqtkyyflsgftaklagtergiteptptfsscfgaafltlpptkyaevlv
    krmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptel
    kgvdtkildprntyadasewevkakdlaerfqknfkkfeslggdlvkagpql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvyA (A:)
    slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
    pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
    entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
    tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaiff
    glsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikrn
    allenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafgv
    lppvsilskeqtkyyflsgftakptptfsscfgaafltlpptkyaevlvkrmeasgakay
    lvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptelkgvdtkildpr
    ntyadasewevkakdlaerfqknfkkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yvyB (B:)
    mslseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgr
    spkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcga
    nentrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglns
    etavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaif
    fglsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikr
    nallenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafg
    vlppvsilskeqtkyyflsgftaklagtergiteptptfsscfgaafltlpptkyaevlv
    krmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptel
    kgvdtkildprntyadasewevkakdlaerfqknfkkfeslggdlvkagpql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvyB (B:)
    slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
    pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
    entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
    tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaiff
    glsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikrn
    allenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafgv
    lppvsilskeqtkyyflsgftaptfsscfgaafltlpptkyaevlvkrmeasgakaylvn
    tgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptelkgvdtkildprnty
    adasewevkakdlaerfqknfkkf