PDB entry 1yvv

View 1yvv on RCSB PDB site
Description: X-Ray structurure of P. syringae Q888A4 oxidoreductase at resolution 2.5A. Northeast Structural Genomics Consortium target Psr10.
Deposited on 2005-02-16, released 2005-04-05
The last revision was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase, flavin-containing
    Species: Pseudomonas syringae [TaxId:317]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q888A4 (Start-327)
      • modified residue (40)
      • modified residue (52)
      • modified residue (108)
      • modified residue (115)
      • modified residue (119)
      • modified residue (181)
      • modified residue (199)
      • modified residue (264)
      • expression tag (328)
  • Chain 'B':
    Compound: amine oxidase, flavin-containing
    Species: Pseudomonas syringae [TaxId:317]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q888A4 (Start-327)
      • modified residue (40)
      • modified residue (52)
      • modified residue (108)
      • modified residue (115)
      • modified residue (119)
      • modified residue (181)
      • modified residue (199)
      • modified residue (264)
      • expression tag (328)
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yvvA (A:)
    mtvpiaiigtgiaglsaaqaltaaghqvhlfdksrgsggrmsskrsdagaldmgaqyfta
    rdrrfatavkqwqaqghvaewtpllynfhagrlspspdeqvrwvgkpgmsaitramrgdm
    pvsfscritevfrgeehwnlldaegqnhgpfshviiatpapqastllaaapklasvvagv
    kmdptwavalafetplqtpmqgcfvqdspldwlarnrskperddtldtwilhatsqwsrq
    nldasreqviehlhgafaelidctmpapvfslahrwlyarpagahewgalsdadlgiyvc
    gdwclsgrvegawlsgqeaarrllehlqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1yvvA (A:)
    tvpiaiigtgiaglsaaqaltaaghqvhlfdksrgsggrmsskrsdagaldmgaqyftar
    drrfatavkqwqaqghvaewtpllynfhagrlspspdeqvrwvgkpgmsaitramrgdmp
    vsfscritevfrgeehwnlldaegqnhgpfshviiatpapqastllaaapklasvvagvk
    mdptwavalafetplqtpmqgcfvqdspldwlarnrskperddtldtwilhatsqwsrqn
    ldasreqviehlhgafaelidctmpapvfslahrwlyarpagahewgalsdadlgiyvcg
    dwclsgrvegawlsgqeaarrllehlql
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yvvB (B:)
    mtvpiaiigtgiaglsaaqaltaaghqvhlfdksrgsggrmsskrsdagaldmgaqyfta
    rdrrfatavkqwqaqghvaewtpllynfhagrlspspdeqvrwvgkpgmsaitramrgdm
    pvsfscritevfrgeehwnlldaegqnhgpfshviiatpapqastllaaapklasvvagv
    kmdptwavalafetplqtpmqgcfvqdspldwlarnrskperddtldtwilhatsqwsrq
    nldasreqviehlhgafaelidctmpapvfslahrwlyarpagahewgalsdadlgiyvc
    gdwclsgrvegawlsgqeaarrllehlqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1yvvB (B:)
    tvpiaiigtgiaglsaaqaltaaghqvhlfdksrgsggrmsskrsdagaldmgaqyftar
    drrfatavkqwqaqghvaewtpllynfhagrlspspdeqvrwvgkpgmsaitramrgdmp
    vsfscritevfrgeehwnlldaegqnhgpfshviiatpapqastllaaapklasvvagvk
    mdptwavalafetplqtpmqgcfvqdspldwlarnrskperddtldtwilhatsqwsrqn
    ldasreqviehlhgafaelidctmpapvfslahrwlyarpagahewgalsdadlgiyvcg
    dwclsgrvegawlsgqeaarrllehlql