PDB entry 1yvu

View 1yvu on RCSB PDB site
Description: Crystal structure of A. aeolicus Argonaute
Class: RNA binding protein, gene regulation
Keywords: RNase H fold
Deposited on 2005-02-16, released 2005-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein aq_1447
    Species: Aquifex aeolicus VF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67434 (Start-705)
      • modified residue (213)
      • modified residue (277)
      • modified residue (449)
      • modified residue (664)
      • modified residue (688)
      • modified residue (702)
    Domains in SCOP 1.73: d1yvua1, d1yvua2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvuA (A:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnp
    krirvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaf
    lvvlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrd
    ygwyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvs
    vykklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlv
    ivfleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlak
    tgnipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafg
    ekltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiik
    rnnprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqil
    sltlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvuA (A:)
    eallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagkv
    ekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkfr
    dkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkri
    rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv
    lekgytypatilkpvltyernevadivrmepgkrlnliryilrryvkalrdygwyispee
    erakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvwrkeeflk
    elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivflefllydfvkr
    ellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegkvdafvgidis
    ritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfslleklgfkkgs
    kivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfikgyfyklseds
    vilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpiklpatvhysdk
    itklmlrgiepikkegdimywl