PDB entry 1yvs

View 1yvs on RCSB PDB site
Description: Trimeric domain swapped barnase
Deposited on 1998-12-10, released 1999-02-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1yvs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvs_ (-)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir