PDB entry 1yvr

View 1yvr on RCSB PDB site
Description: Ro autoantigen
Class: RNA binding protein
Keywords: HEAT repeat; von Willebrand Factor A; Rossmann fold; MIDAS motif', RNA BINDING PROTEIN
Deposited on 2005-02-16, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60-kDa SS-A/Ro ribonucleoprotein
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yvra1, d1yvra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvrA (A:)
    meatmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaea
    llrliedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcr
    ipthlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshk
    dllrlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkd
    eleiihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapasse
    vssvcerltnekllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyks
    fklveptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdeml
    pcpitvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpa
    talkqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvrA (A:)
    mdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallrl
    iedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcripth
    lftfiqfkkdlwgralrkavsdwyntkdalnlamavtkykqrngwshkdllrlshikpan
    egltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkdeleiihlideyr
    lvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevssvcerltnek
    llkkarihpfhilvaletykkghlrwipdtsivealdnafyksfklveptgkrfllaidv
    sasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcpitvnmllhevvekm
    sditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatalkqyrekmgipakli
    vcamtsngfsiadpddrgmldicgfdsgaldvirnftldl