PDB entry 1yvp

View 1yvp on RCSB PDB site
Description: Ro autoantigen complexed with RNAs
Class: RNA binding protein/RNA
Keywords: HEAT repeat; von Willebrand Factor A; Rossmann fold; MIDAS motif; RNA duplex; ssRNA
Deposited on 2005-02-16, released 2005-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60-kDa SS-A/Ro ribonucleoprotein
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yvpa1, d1yvpa2
  • Chain 'B':
    Compound: 60-kDa SS-A/Ro ribonucleoprotein
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yvpb1, d1yvpb2
  • Chain 'C':
    Compound: Y RNA sequence, first strand
  • Chain 'D':
    Compound: Y RNA sequence, second strand
  • Chain 'E':
    Compound: Y RNA sequence, first strand
  • Chain 'F':
    Compound: Y RNA sequence, second strand
  • Chain 'G':
    Compound: Y RNA sequence, first strand
  • Chain 'H':
    Compound: Y RNA sequence, first strand
  • Heterogens: ACT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvpA (A:)
    meatmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaea
    llrliedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcr
    ipthlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshk
    dllrlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkd
    eleiihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapasse
    vssvcerltnekllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyks
    fklveptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdeml
    pcpitvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpa
    talkqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvpA (A:)
    mdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallrl
    iedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcripth
    lftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshkdllr
    lshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkdelei
    ihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevssv
    cerltnekllkkarihpfhilvaletykkghglrwipdtsivealdnafyksfklveptg
    krfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcpitvnm
    llhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatalkqyre
    kmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yvpB (B:)
    meatmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaea
    llrliedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcr
    ipthlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshk
    dllrlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkd
    eleiihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapasse
    vssvcerltnekllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyks
    fklveptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdeml
    pcpitvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpa
    talkqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvpB (B:)
    tmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallr
    liedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcript
    hlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshkdll
    rlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkdele
    iihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevss
    vcerltnekllkkarihpfhilvaletykkghgnklrwipdtsivealdnafyksfklve
    ptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcpit
    vnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatalkq
    yrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.