PDB entry 1yvo

View 1yvo on RCSB PDB site
Description: hypothetical acetyltransferase from P.aeruginosa PA01
Class: transferase
Keywords: Hypothetical protein, structural genomics, hypothetical acetyltransferase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-02-16, released 2005-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • modified residue (118)
      • modified residue (144)
      • modified residue (160)
    Domains in SCOPe 2.06: d1yvoa1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • modified residue (118)
      • modified residue (144)
      • modified residue (160)
    Domains in SCOPe 2.06: d1yvob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvoA (A:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvoA (A:)
    sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasdaag
    evlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaai
    esgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yvoB (B:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvoB (B:)
    sasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasda
    agevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmva
    aiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap