PDB entry 1yvn

View 1yvn on RCSB PDB site
Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Deposited on 1999-03-23, released 2000-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-23, with a file datestamp of 2000-03-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvnA (A:)
    evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg
    iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim
    fetfnvpafyvsiqavlslyssgrttgivldsgdgnthvvpiyagfslphailridlagr
    dltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksyelp
    dgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivmsggt
    tmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskqeyd
    esgpsivhhkcf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvnG (G:)
    mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
    lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
    vasgf