PDB entry 1yvn

View 1yvn on RCSB PDB site
Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Class: structural protein
Keywords: yeast, actin, mutant v159n, gelsolin, actin-binding, mg-ATP, structural protein
Deposited on 1999-03-23, released 2000-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (actin)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60010 (Start-374)
      • engineered mutation (158)
    Domains in SCOPe 2.08: d1yvna1, d1yvna2
  • Chain 'G':
    Compound: protein (gelsolin)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yvng_
  • Heterogens: MG, SO4, ATP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvnA (A:)
    mdsevaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqs
    krgiltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmt
    qimfetfnvpafyvsiqavlslyssgrttgivldsgdgnthvvpiyagfslphailridl
    agrdltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksy
    elpdgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivms
    ggttmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskq
    eydesgpsivhhkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvnA (A:)
    evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg
    iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim
    fetfnvpafyvsiqavlslyssgrttgivldsgdgnthvvpiyagfslphailridlagr
    dltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksyelp
    dgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivmsggt
    tmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskqeyd
    esgpsivhhkcf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvnG (G:)
    mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
    lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
    vasgf