PDB entry 1yvm

View 1yvm on RCSB PDB site
Description: E. coli Methionine Aminopeptidase in complex with thiabendazole
Class: Hydrolase
Keywords: hydrolase(alpha-aminoacylpeptide), metal complex, thiabendazole, methionine aminopeptidase, inhibitor
Deposited on 2005-02-16, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07906
      • engineered (174)
    Domains in SCOPe 2.07: d1yvma_
  • Heterogens: CO, NA, TMG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvmA (A:)
    maisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsacl
    gyhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkpti
    mgerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfhee
    pqvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivv
    tdngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvmA (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishd