PDB entry 1yvl

View 1yvl on RCSB PDB site
Description: Structure of Unphosphorylated STAT1
Deposited on 2005-02-16, released 2005-03-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal transducer and activator of transcription 1-alpha/beta
    Species: Homo sapiens [TaxId:9606]
    Gene: STAT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: signal transducer and activator of transcription 1-alpha/beta
    Species: Homo sapiens [TaxId:9606]
    Gene: STAT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YVL
  • Chain 'D':
    Compound: 5-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YVL (0-4)
  • Heterogens: AU

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yvlA (A:)
    msqwyelqqldskfleqvhqlyddsfpmeirqylaqwlekqdwehaandvsfatirfhdl
    lsqlddqysrfslennfllqhnirkskrnlqdnfqedpiqmsmiiysclkeerkilenaq
    rfnqaqsgniqstvmldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnr
    ehetngvaksdqkqeqlllkkmylmldnkrkevvhkiiellnvteltqnalindelvewk
    rrqqsaciggppnacldqlqnwftivaeslqqvrqqlkkleeleqkytyehdpitknkqv
    lwdrtfslfqqliqssfvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkv
    kvlfdkdvnerntvkgfrkfnilgthtkvmnmeestngslaaefrhlqlkeqknagtrtn
    egplivteelhslsfetqlcqpglvidlettslpvvvisnvsqlpsgwasilwynmlvae
    prnlsffltppcarwaqlsevlswqfssvtkrglnvdqlnmlgekllgpnaspdglipwt
    rfckenindknfpfwlwiesilelikkhllplwndgcimgfiskererallkdqqpgtfl
    lrfsessregaitftwversqnggepdfhavepytkkelsavtfpdiirnykvmaaenip
    enplkylypnidkdhafgkyysr
    

    Sequence, based on observed residues (ATOM records):
    >1yvlA (A:)
    sqwyelqqldskfleqvhqlyddsfpmeirqylaqwlekqdwehaandvsfatirfhdll
    sqlddqysrfslennfllqhnirkskrnlqdnfqedpiqmsmiiysclkeerkilenaqr
    fnqaqtvmldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnreaksdqk
    qeqlllkkmylmldnkrkevvhkiiellnvteltqnalindelvewkrrqqsaciggppn
    acldqlqnwftivaeslqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqli
    qssfvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnernt
    vkgfrkfnilgthtkvmnmeestngslaaefrhlqlkeqknivteelhslsfetqlcqpg
    lvidlettslpvvvisnvsqlpsgwasilwynmlvaeprnlsffltppcarwaqlsevls
    wqfssvtkrglnvdqlnmlgekllgpnaspdglipwtrfckknfpfwlwiesilelikkh
    llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqepdfhav
    epytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yvlB (B:)
    msqwyelqqldskfleqvhqlyddsfpmeirqylaqwlekqdwehaandvsfatirfhdl
    lsqlddqysrfslennfllqhnirkskrnlqdnfqedpiqmsmiiysclkeerkilenaq
    rfnqaqsgniqstvmldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnr
    ehetngvaksdqkqeqlllkkmylmldnkrkevvhkiiellnvteltqnalindelvewk
    rrqqsaciggppnacldqlqnwftivaeslqqvrqqlkkleeleqkytyehdpitknkqv
    lwdrtfslfqqliqssfvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkv
    kvlfdkdvnerntvkgfrkfnilgthtkvmnmeestngslaaefrhlqlkeqknagtrtn
    egplivteelhslsfetqlcqpglvidlettslpvvvisnvsqlpsgwasilwynmlvae
    prnlsffltppcarwaqlsevlswqfssvtkrglnvdqlnmlgekllgpnaspdglipwt
    rfckenindknfpfwlwiesilelikkhllplwndgcimgfiskererallkdqqpgtfl
    lrfsessregaitftwversqnggepdfhavepytkkelsavtfpdiirnykvmaaenip
    enplkylypnidkdhafgkyysr
    

    Sequence, based on observed residues (ATOM records):
    >1yvlB (B:)
    sqwyelqqldskfleqvhqlyddsfpmeirqylaqwlekqdwehaandvsfatirfhdll
    sqlddqysrfslennfllqhnirkskrnlqdnfqedpiqmsmiiysclkeerkilenaqr
    fnmldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnrehdqkqeqlllk
    kmylmldnkrkevvhkiiellnvteltqnalindelvewkrrqqsaciggppnacldqlq
    nwftivaeslqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqliqssfvve
    rqpcmpthpqrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnerntvkgfrkf
    nilgthtkvmnmeestngslaaefrhlqlkeqgplivteelhslsfetqlcqpglvidle
    ttslpvvvisnvsqlpsgwasilwynmlvaeprnlsffltppcarwaqlsevlswqfssv
    tkrglnvdqlnmlgekllgpnaspdglipwtrfckenindknfpfwlwiesilelikkhl
    lplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversnggepdfha
    vepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1yvlC (C:)
    ydkph
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1yvlD (D:)
    ydkph