PDB entry 1yvi

View 1yvi on RCSB PDB site
Description: x-ray structure of putative histidine-containing phosphotransfer protein from rice, ak104879
Class: signaling protein
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AK104879, PHOSPHORELAY MEDIATOR, HP1, Center for Eukaryotic Structural Genomics, SIGNALING PROTEIN
Deposited on 2005-02-15, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing phosphotransfer protein
    Species: Oryza sativa [TaxId:4530]
    Gene: AK104879
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6VAK4 (0-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yvia1, d1yvia2
  • Chain 'B':
    Compound: histidine-containing phosphotransfer protein
    Species: Oryza sativa [TaxId:4530]
    Gene: AK104879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yvib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yviA (A:)
    saaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriine
    iatlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavv
    rndfydlrnkfqtmlqleqqiqaydpkqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yviA (A:)
    saaaalrdqltallssmfsqglvdeqfqqlqmlqdtpgfvsevvtlfcddadriineiat
    lleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrnd
    fydlrnkfqtmlqleqqiqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yviB (B:)
    saaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriine
    iatlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavv
    rndfydlrnkfqtmlqleqqiqaydpkqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yviB (B:)
    aaalrdqltallssmfsqglvdeqfqqlqmlqdpgfvsevvtlfcddadriineiatlle
    qpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrndfyd
    lrnkfqtmlqleqqiq