PDB entry 1yvh

View 1yvh on RCSB PDB site
Description: Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide
Class: ligase,signaling protein,immune system
Keywords: x-ray crystallography; phosphotyrosine; adapter protein, ligase,signaling protein,immune system
Deposited on 2005-02-15, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CBL E3 ubiquitin protein ligase
    Species: Homo sapiens [TaxId:9606]
    Gene: CBL, CBL2, RNF55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yvha1, d1yvha2, d1yvha3
  • Chain 'B':
    Compound: 13-mer fragment of SH2 and PH domain-containing adapter protein APS
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z200
      • modified residue (9)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvhA (A:)
    gsliglmkdafqphhhhhhhlsphppgtvdkkmvekcwklmdkvvrlcqnpklalknspp
    yildllpdtyqhlrtilsryegkmetlgeneyfrvfmenlmkktkqtislfkegkermye
    ensqprrnltklslifshmlaelkgifpsglfqgdtfritkadaaefwrkafgektivpw
    ksfrqalhevhpissgleamalkstidltcndyisvfefdiftrlfqpwssllrnwnsla
    vthpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnk
    plfqalidgfregfylfpdgrnqnpdltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvhA (A:)
    pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
    tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
    ifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkst
    idltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfihk
    pgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqnp
    dltg
    

  • Chain 'B':
    No sequence available.