PDB entry 1yve

View 1yve on RCSB PDB site
Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)
Class: oxidoreductase
Keywords: oxidoreductase, branched-chain amino acid biosynthesis, magnesium, nadp, chloroplast, transit peptide
Deposited on 1996-10-11, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: acetohydroxy acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Gene: CDNA FROM ACETOHYDROXY ACID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yvei1, d1yvei2
  • Chain 'J':
    Compound: acetohydroxy acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Gene: CDNA FROM ACETOHYDROXY ACID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yvej1, d1yvej2
  • Chain 'K':
    Compound: acetohydroxy acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Gene: CDNA FROM ACETOHYDROXY ACID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yvek1, d1yvek2
  • Chain 'L':
    Compound: acetohydroxy acid isomeroreductase
    Species: Spinacia oleracea [TaxId:3562]
    Gene: CDNA FROM ACETOHYDROXY ACID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yvel1, d1yvel2
  • Heterogens: MG, CL, NDP, HIO, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yveI (I:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yveI (I:)
    attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq
    nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd
    saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly
    vqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergi
    llgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkk
    dfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmw
    kvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdsln
    pfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdp
    vheaigvcaqlrpsvdisvtadadfvrpelrqa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yveJ (J:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yveJ (J:)
    fdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqnlk
    dslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisdsaq
    adnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyvqg
    kevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergillg
    avhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkkdfq
    aaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmwkvg
    ekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdslnpfm
    hargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdpvhe
    aigvcaqlrpsvdisvtadadfvrpelrqa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1yveK (K:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yveK (K:)
    fdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqnlk
    dslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisdsaq
    adnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyvqg
    kevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergillg
    avhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkkdfq
    aaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmwkvg
    ekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdslnpfm
    hargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdpvhe
    aigvcaqlrpsvdisvtadadfvrpelrqa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1yveL (L:)
    mvsapsidtpsattfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvi
    gwgsqapaqaqnlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetis
    gsdlvlllisdsaqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcp
    kgmgpsvrrlyvqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqe
    yksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmla
    lynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiin
    esvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapin
    qdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yveL (L:)
    attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq
    nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd
    saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly
    vqgkevngaginssfavhqdvdgratdvalgwsialgspftfattleqeyksdifgergi
    llgavhgiveclfrrytesgmsedlaykntvecitgvisktistkgmlalynslseegkk
    dfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeglpafpmgkidqtrmw
    kvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsyseiinesvieavdsln
    pfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdngapinqdlisnflsdp
    vheaigvcaqlrpsvdisvtadadfvrpelrqa