PDB entry 1yvd

View 1yvd on RCSB PDB site
Description: GppNHp-Bound Rab22 GTPase
Class: protein transport
Keywords: Rab GTPase, Rab22, Vesicular trafficking, protein transport
Deposited on 2005-02-15, released 2005-07-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-22A
    Species: Mus musculus [TaxId:10090]
    Gene: Rab22a, Rab22
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35285 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.05: d1yvda1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvdA (A:)
    gslrelkvcllgdtgvgkssivwrfvedsfdpninptigasfmtktvqyqnelhkfliwd
    tagqerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkc
    dltdvrevmerdakdyadsihaifvetsaknaininelfieisrripst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvdA (A:)
    slrelkvcllgdtgvgkssivwrfvedsfdpninptigasfmtktvqyqnelhkfliwdt
    agqerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkcd
    ltdvrevmerdakdyadsihaifvetsaknaininelfieisrrip