PDB entry 1yvb

View 1yvb on RCSB PDB site
Description: the Plasmodium falciparum Cysteine Protease Falcipain-2
Class: hydrolase/hydrolase inhibitor
Keywords: cysteine protease-inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-02-15, released 2006-03-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: falcipain 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: AF239801
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9N6S8 (0-240)
      • engineered (0)
      • engineered (0)
      • engineered (99)
      • engineered (101)
    Domains in SCOPe 2.01: d1yvba1
  • Chain 'I':
    Compound: cystatin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yvbi_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvbA (A:)
    qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
    klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
    ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
    fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
    e
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvbI (I:)
    rllgapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqve
    igrttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq