PDB entry 1yv7

View 1yv7 on RCSB PDB site
Description: X-ray structure of (C87S,des103-104) onconase
Class: hydrolase
Keywords: crystal structure, small conformational changes, onconase thermal stability, ribonucleases, antitumor action, dynamics, HYDROLASE
Deposited on 2005-02-15, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.145
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P-30 protein
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22069 (0-101)
      • modified residue (0)
      • engineered (86)
    Domains in SCOPe 2.07: d1yv7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yv7A (A:)
    edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
    sefylsdcnvtsrpckyklkkstnkfsvtcenqapvhfvgvg