PDB entry 1yv6

View 1yv6 on RCSB PDB site
Description: X-ray structure of M23L onconase at 298K
Class: hydrolase
Keywords: crystal structure, small conformational changes, onconase thermal stability, ribonucleases, antitumor action, dynamics, HYDROLASE
Deposited on 2005-02-15, released 2005-03-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P-30 protein
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22069 (0-103)
      • modified residue (0)
      • engineered (22)
    Domains in SCOPe 2.03: d1yv6a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yv6A (A:)
edwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc