PDB entry 1yv3

View 1yv3 on RCSB PDB site
Description: The structural basis of blebbistatin inhibition and specificity for myosin II
Deposited on 2005-02-14, released 2005-03-08
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799
      • see remark 999 (248)
      • see remark 999 (311)
  • Heterogens: MG, VO4, ADP, BIT, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yv3A (A:)
    gnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records):
    >1yv3A (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglf
    lvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesg
    agktentkkviqylasvagrvleqqilqanpileafgnakttrnnnssrfgkfieiqfns
    agfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnq
    sgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavl
    kdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrl
    flwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfkl
    eqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhs
    hfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvt
    klfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakled
    kvvldqlrcngvlegiritrkgfpnriiyfvqyrfgitkiffr