PDB entry 1yv2

View 1yv2 on RCSB PDB site
Description: Hepatitis C virus NS5B RNA-dependent RNA Polymerase genotype 2a
Class: transferase
Keywords: NS5B Polymerase genotype 2a, TRANSFERASE
Deposited on 2005-02-14, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA dependent RNA polymerase
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26660 (0-End)
      • see remark 999 (24)
      • see remark 999 (149)
      • see remark 999 (155)
      • see remark 999 (211)
      • see remark 999 (308)
      • see remark 999 (390)
    Domains in SCOPe 2.07: d1yv2a_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yv2A (A:)
    smsyswtgalitpcspeeeklpinplsnsllryhnkvycttsksaslrakkvtfdrmqvl
    dayydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
    svwkdlledsqtpipttimaknevfcvdptkggkkaarlivypdlgvrvcekmalydvtq
    klpqavmgasygfqyspaqrvefllkawaekkdpmgfsydtrcfdstvterdirteesiy
    qacslpeeartaihslterlyvggpmfnskgqscgyrrcrasgvlttsmgntitcyvkal
    aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
    elitscssnvsvalgpqgrrryyltrdpttpiaraawetvrhspvnswlgniiqyaptiw
    vrmvlmthffsilmaqdtldqnlnfemygsvysvspldlpaiierlhgldafslhtytph
    eltrvasalrklgapplrawksraravraslisrggraavcgrylfnwavktklkltplp
    earlldlsswftvgagggdiyhsvsrarpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yv2A (A:)
    smsyswtgalitpcspeeeklpinplsnsllryhnkvycttsksaslrakkvtfdrmqvl
    dayydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
    svwkdlledsqtpipttimaknevfcvdptkggkkaarlivypdlgvrvcekmalydvtq
    klpqavmgasygfqyspaqrvefllkawaekkdpmgfsydtrcfdstvterdirteesiy
    qacslpeeartaihslterlyvggpmfnskgqscgyrrcrasgvlttsmgntitcyvkal
    aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
    elitscssnvsvalgpqgrrryyltrdpttpiaraawetvrhspvnswlgniiqyaptiw
    vrmvlmthffsilmaqdtldqnlnfemygsvysvspldlpaiierlhgldafslhtytph
    eltrvasalrklgapplrawksraravraslisrggraavcgrylfnwavktklkltplp
    earlldls