PDB entry 1yv0

View 1yv0 on RCSB PDB site
Description: Crystal structure of skeletal muscle troponin in the Ca2+-free state
Class: contractile protein
Keywords: troponin, off state, thin filament, actin binding, muscle, CONTRACTILE PROTEIN
Deposited on 2005-02-14, released 2005-04-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 7 Å
R-factor: 0.358
AEROSPACI score: -0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: troponin c, skeletal muscle
    Species: Gallus gallus [TaxId:9031]
    Gene: TNNC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yv0c1
  • Chain 'I':
    Compound: Troponin I, fast skeletal muscle
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68246
      • engineered (47)
      • engineered (63)
    Domains in SCOPe 2.04: d1yv0i1
  • Chain 'T':
    Compound: Troponin T, fast skeletal muscle isoforms
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yv0t1
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yv0C (C:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
    ilratgehvteediedlmkdsdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yv0C (C:)
    tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
    evdedgsgtidfeeflvmmvrqelancfrifdknadgfidieelgeilratgehvteedi
    edlmkdsdknndgridfdeflkmmegvq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yv0I (I:)
    sdeekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqel
    qelskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsada
    mlrallgskhkvnmdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yv0I (I:)
    eekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqelqe
    lskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsa
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1yv0T (T:)
    mgasyssylakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyq
    lqtekydfaeqikrkkyeivtlrnridqaqkhskkagakgkvggrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yv0T (T:)
    lakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqtekydf
    aeqikrkkyeivtlrnridqaqkhs