PDB entry 1yur
View 1yur on RCSB PDB site
Description: Solution structure of apo-S100A13 (minimized mean structure)
Class: metal binding protein
Keywords: S100A13, EF hand calcium-binding proteins, Copper(II), NMR structure, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL BINDING PROTEIN
Deposited on
2005-02-14, released
2005-10-18
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: S100 calcium-binding protein A13
Species: Homo sapiens [TaxId:9606]
Gene: S100A13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1yura1 - Chain 'B':
Compound: S100 calcium-binding protein A13
Species: Homo sapiens [TaxId:9606]
Gene: S100A13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1yurb1
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1yurA (A:)
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1yurB (B:)
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk