PDB entry 1yur

View 1yur on RCSB PDB site
Description: Solution structure of apo-S100A13 (minimized mean structure)
Class: metal binding protein
Keywords: S100A13, EF hand calcium-binding proteins, Copper(II), NMR structure, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL BINDING PROTEIN
Deposited on 2005-02-14, released 2005-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: S100 calcium-binding protein A13
  Species: Homo sapiens [TaxId:9606]
  Gene: S100A13
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99584 (0-97)
  Domains in SCOPe 2.08: d1yura1
• Chain 'B':
  Compound: S100 calcium-binding protein A13
  Species: Homo sapiens [TaxId:9606]
  Gene: S100A13
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99584 (0-97)
  Domains in SCOPe 2.08: d1yurb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yurA (A:)
  maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
  ksldvnqdselkfneywrligelakeirkkkdlkirkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yurB (B:)
  maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
  ksldvnqdselkfneywrligelakeirkkkdlkirkk