PDB entry 1yum

View 1yum on RCSB PDB site
Description: Crystal Structure of Nicotinic Acid Mononucleotide Adenylyltransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: alpha/beta domain, TRANSFERASE
Deposited on 2005-02-14, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 'Probable nicotinate-nucleotide adenylyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: nadD (PA4006)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yuma_
  • Chain 'B':
    Compound: 'Probable nicotinate-nucleotide adenylyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: nadD (PA4006)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yumb_
  • Chain 'C':
    Compound: 'Probable nicotinate-nucleotide adenylyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: nadD (PA4006)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yumc_
  • Chain 'D':
    Compound: 'Probable nicotinate-nucleotide adenylyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: nadD (PA4006)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yumd_
  • Heterogens: CIT, NCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yumA (A:)
    mgsshhhhhhssglvprgshmgkriglfggtfdpvhighmrsavemaeqfaldelrllpn
    arpphretpqvsaaqrlamveravagverltvdprelqrdkpsytidtlesvraelaadd
    qlfmligwdafcglptwhrwealldhchivvlqrpdadseppeslrdllaarsvadpqal
    kgpggqitfvwqtplavsatqirallgagrsvrflvpdavlnyieahhlyraphlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yumA (A:)
    gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
    ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
    alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
    irallgagrsvrflvpdavlnyieahhlyrap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yumB (B:)
    mgsshhhhhhssglvprgshmgkriglfggtfdpvhighmrsavemaeqfaldelrllpn
    arpphretpqvsaaqrlamveravagverltvdprelqrdkpsytidtlesvraelaadd
    qlfmligwdafcglptwhrwealldhchivvlqrpdadseppeslrdllaarsvadpqal
    kgpggqitfvwqtplavsatqirallgagrsvrflvpdavlnyieahhlyraphlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yumB (B:)
    gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
    ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
    alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
    irallgagrsvrflvpdavlnyieahhlyrap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yumC (C:)
    mgsshhhhhhssglvprgshmgkriglfggtfdpvhighmrsavemaeqfaldelrllpn
    arpphretpqvsaaqrlamveravagverltvdprelqrdkpsytidtlesvraelaadd
    qlfmligwdafcglptwhrwealldhchivvlqrpdadseppeslrdllaarsvadpqal
    kgpggqitfvwqtplavsatqirallgagrsvrflvpdavlnyieahhlyraphlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yumC (C:)
    gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
    ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
    alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
    irallgagrsvrflvpdavlnyieahhlyrap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yumD (D:)
    mgsshhhhhhssglvprgshmgkriglfggtfdpvhighmrsavemaeqfaldelrllpn
    arpphretpqvsaaqrlamveravagverltvdprelqrdkpsytidtlesvraelaadd
    qlfmligwdafcglptwhrwealldhchivvlqrpdadseppeslrdllaarsvadpqal
    kgpggqitfvwqtplavsatqirallgagrsvrflvpdavlnyieahhlyraphlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yumD (D:)
    gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
    ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
    alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
    irallgagrsvrflvpdavlnyieahhlyrap