PDB entry 1yul

View 1yul on RCSB PDB site
Description: Crystal Structure of Nicotinic Acid Mononucleotide Adenylyltransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: alpha/beta domain, TRANSFERASE
Deposited on 2005-02-14, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable nicotinate-nucleotide adenylyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: nadD (PA4006)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HX21
      • modified residue (39)
      • modified residue (45)
      • modified residue (78)
      • modified residue (123)
    Domains in SCOPe 2.07: d1yula_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yulA (A:)
    mgsshhhhhhssglvprgshmgkriglfggtfdpvhighmrsavemaeqfaldelrllpn
    arpphretpqvsaaqrlamveravagverltvdprelqrdkpsytidtlesvraelaadd
    qlfmligwdafcglptwhrwealldhchivvlqrpdadseppeslrdllaarsvadpqal
    kgpggqitfvwqtplavsatqirallgagrsvrflvpdavlnyieahhlyraphlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yulA (A:)
    gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
    ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
    alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
    irallgagrsvrflvpdavlnyieahhlyr