PDB entry 1yuk

View 1yuk on RCSB PDB site
Description: the crystal structure of the psi/hybrid domain/ i-egf1 segment from the human integrin beta2 at 1.8 resolution
Deposited on 2005-02-14, released 2005-07-19
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.234
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin beta-2 A chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Integrin beta-2 B chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05107 (0-117)
      • expression tag (118-119)
  • Heterogens: NDG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yukA (A:)
    qectkfkvsscreciesgpgctwcqklnftgpgdpdsircdtrpqllmrgcaaddimdpt
    slaetqedhnggqkqlspqkvtlylrpgqaaafnvtfrrakgy
    

    Sequence, based on observed residues (ATOM records):
    >1yukA (A:)
    qectkfkvsscreciesgpgctwcqklnftgpgdpdsircdtrpqllmrgcaaddimdpt
    slaetqeqkqlspqkvtlylrpgqaaafnvtfrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yukB (B:)
    srvfldhnalpdtlkvtydsfcsngvthrnqprgdcdgvqinvpitfqvkvtateciqeq
    sfviralgftdivtvqvlpqcecrcrdqsrdrslchgkgflecgicrcdtgyigkncehh