PDB entry 1yuh

View 1yuh on RCSB PDB site
Description: fab fragment
Class: immunoglobulin
Keywords: anti-nitrophenol, lambda light chain, immunoglobulin
Deposited on 1996-01-30, released 1996-07-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.19
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 88c6/12 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-210)
      • conflict (42)
      • conflict (55)
      • conflict (158)
      • conflict (182)
      • conflict (190)
    Domains in SCOPe 2.01: d1yuha1, d1yuha2
  • Chain 'B':
    Compound: 88c6/12 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (6-217)
      • conflict (8)
      • conflict (19)
      • conflict (32)
      • conflict (36)
      • conflict (39)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53)
      • conflict (55-56)
      • conflict (59)
      • conflict (65)
      • conflict (71)
      • conflict (74)
      • conflict (96)
      • conflict (98-99)
      • insertion (101)
      • conflict (112)
      • conflict (119)
      • conflict (162)
      • conflict (189)
      • conflict (195)
      • conflict (209)
    Domains in SCOPe 2.01: d1yuhb1, d1yuhb2
  • Chain 'H':
    Compound: 88c6/12 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (6-217)
      • conflict (8)
      • conflict (19)
      • conflict (32)
      • conflict (36)
      • conflict (39)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53)
      • conflict (55-56)
      • conflict (59)
      • conflict (65)
      • conflict (71)
      • conflict (74)
      • conflict (96)
      • conflict (98-99)
      • insertion (101)
      • conflict (112)
      • conflict (119)
      • conflict (162)
      • conflict (189)
      • conflict (195)
      • conflict (209)
    Domains in SCOPe 2.01: d1yuhh1, d1yuhh2
  • Chain 'L':
    Compound: 88c6/12 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-210)
      • conflict (42)
      • conflict (55)
      • conflict (158)
      • conflict (182)
      • conflict (190)
    Domains in SCOPe 2.01: d1yuhl1, d1yuhl2
  • Heterogens: NP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhA (A:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpskqsnnkymassyl
    tlsarawerhasyscqvtheghtvekslsra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhB (B:)
    qvqfqqsgaelvkpgasvklsckasgytftsylmhwikqrpgrglewigridpnnvvtkf
    nekfkskatltvdkpsstaymelssltsedsavyycaryaycrpmdywgqgttvtvssaa
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdly
    tlsssvtvpastwpsgtvtcnvahpasstavdkkivpr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhH (H:)
    qvqfqqsgaelvkpgasvklsckasgytftsylmhwikqrpgrglewigridpnnvvtkf
    nekfkskatltvdkpsstaymelssltsedsavyycaryaycrpmdywgqgttvtvssaa
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdly
    tlsssvtvpastwpsgtvtcnvahpasstavdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpskqsnnkymassyl
    tlsarawerhasyscqvtheghtvekslsra