PDB entry 1yuf

View 1yuf on RCSB PDB site
Description: type alpha transforming growth factor, nmr, 16 models without energy minimization
Deposited on 1996-04-01, released 1996-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1yuf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuf_ (-)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla