PDB entry 1yuf

View 1yuf on RCSB PDB site
Description: type alpha transforming growth factor, nmr, 16 models without energy minimization
Class: growth factor
Keywords: egf-like domain structure, growth factor
Deposited on 1996-04-01, released 1996-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming growth factor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TGF-ALPHA 1YUF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yufa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yufA (A:)
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla