PDB entry 1yue

View 1yue on RCSB PDB site
Description: Bacteriophage T4 capsid vertex protein gp24
Deposited on 2005-02-14, released 2005-04-26
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.27
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Head vertex protein Gp24
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 24
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19896
      • modified residue (205)
      • modified residue (252)
      • modified residue (256)
      • modified residue (402)
      • modified residue (405)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yueA (A:)
    makinellrestttnsnsigrpnlvaltrattkliysdivatqrtnqpvaafygikylnp
    dneftfktgatyageagyvdreqitelteeskltlnkgdlfkynnivykvledtpfatie
    esdlelalqiaivllkvrlfsdaastskfessdseiadarfqinkwqtavksrklktgit
    velaqdleangfdapnfledllatemadeinkdilqslitvskrykvtgitdsgfidlsy
    asapeagrslyrmvcemvshiqkestytatfcvasaraaailaasgwlkhkpeddkylsq
    naygflanglplycdtnspldyvivgvvenigekeivgsifyapytegldlddpehvgaf
    kvvvdpeslqpsigllvryalsanpytvakdekeariidggdmdkmagrsdlsvllgvkl
    pkiiide
    

    Sequence, based on observed residues (ATOM records):
    >1yueA (A:)
    akinellrestttnsnsigrpnlvaltrattkliysdivatqrtnqpvaafygikylnpd
    neqitelteeskltlnkgdlfkynnivykvledtpfatieesdlelalqiaivllkvrlf
    sdeiadarfqinkwqtavksrklktgitvelaqdleangfdapnfledllatemadeink
    dilqslitvskrykvtgitdsgfidlsyasapeagrslyrmvcemvshiqkestytatfc
    vasaraaailaasgwlkhkpeddkylsqnaygflanglplycdtnspldyvivgvvenig
    ekeivgsifyapytegldlddpehvgafkvvvdpeslqpsigllvryalsanpytvakde
    keariidggdmdkmagrsdlsvllgvklpk