PDB entry 1yua

View 1yua on RCSB PDB site
Description: c-terminal domain of escherichia coli topoisomerase I
Class: DNA binding protein
Keywords: gene-regulating protein, DNA binding protein
Deposited on 1995-03-02, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: topoisomerase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yuaa1, d1yuaa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuaA (A:)
    mngevappkedpvplpelpceksdayfvlrdgaagvflaantfpksretraplveelyrf
    rdrlpeklryladapqqdpegnktmvrfsrktkqqyvssekdgkatgwsafyvdgkwveg
    kk